New window

ID: GDB33A_4501857

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB33A_4501857
         (430 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109497 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase,...   148   5e-37
gnl|CDD|111644 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase,...   132   3e-32
gnl|CDD|111643 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase,...    86   3e-18
gnl|CDD|116638 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase,...    44   2e-05
gnl|CDD|118191 pfam09659, Cas_Csm6, CRISPR-associated protein (C...    32   0.088
gnl|CDD|111635 pfam02759, RUN, RUN domain.  This domain is prese...    29   0.84 

>gnl|CDD|109497 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal
           domain.  C-terminal domain of Acyl-CoA dehydrogenase is
           an all-alpha, four helical up-and-down bundle.
          Length = 150

 Score =  148 bits (377), Expect = 5e-37
 Identities = 63/149 (42%), Positives = 87/149 (58%)

Query: 278 NKGFYYIMKELPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL 337
            +GF   M+ L  ERLLIA +A+ A+    EE   Y +QR AFG+ +   Q ++HKLA++
Sbjct: 1   GRGFAVAMETLNHERLLIAAMALGAARRALEEALEYARQRTAFGRPLIDFQLIRHKLADM 60

Query: 338 KTHICVTRAFVDNCLQLHEAKRLDSATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYP 397
              +   R  V    +  +A   D A A MAK +ASEL   VA D +QL GG+GY  EYP
Sbjct: 61  AAELEAARLLVYRAAEALDAGAPDPAEAAMAKLYASELAQEVADDAMQLLGGYGYSREYP 120

Query: 398 IAKAYVDARVQPIYGGTNEIMKELIAREI 426
           + + Y DARV  I  GT+EI + +IAR +
Sbjct: 121 LERLYRDARVLRIGEGTSEIQRNIIARRL 149


>gnl|CDD|111644 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, N-terminal
           domain.  The N-terminal domain of Acyl-CoA dehydrogenase
           is an all-alpha domain.
          Length = 113

 Score =  132 bits (336), Expect = 3e-32
 Identities = 46/113 (40%), Positives = 70/113 (61%), Gaps = 1/113 (0%)

Query: 54  SPEHDIFRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGGIGGD 113
           + E +  R +VR+F +EEV PH +EW++ GE  RE+W K G+ GLLG+ I E  GG G D
Sbjct: 1   TEEQEALRDTVREFAEEEVAPHAAEWDEEGEFPRELWRKLGELGLLGLTIPEEYGGAGLD 60

Query: 114 LYSAAIVWEEQAYSNCS-GPGFSIHSGIVMSYITNHGSEEQIKHFIPQMTAGK 165
               A+V EE A ++ S G    +HS +V   I   G+EEQ + ++P++ +G+
Sbjct: 61  YLEYALVAEELARADASLGLALGVHSSLVAPPILRFGTEEQKEKYLPKLASGE 113


>gnl|CDD|111643 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middle domain.
           Central domain of Acyl-CoA dehydrogenase has a
           beta-barrel fold.
          Length = 51

 Score = 86.4 bits (215), Expect = 3e-18
 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 1/51 (1%)

Query: 169 AIAMTEPGAGSDLQGIKTNAKKDGSDWILNGSKVFISNGSLSDVVIVVAVT 219
           A A+TEPGAGSDL  ++T A KDG D++LNGSK FI+N  ++DV +V+A T
Sbjct: 1   AFALTEPGAGSDLAALRTTAVKDG-DYVLNGSKWFITNAGVADVALVLART 50


>gnl|CDD|116638 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, C-terminal
           domain. 
          Length = 133

 Score = 43.8 bits (104), Expect = 2e-05
 Identities = 24/132 (18%), Positives = 41/132 (31%), Gaps = 10/132 (7%)

Query: 295 IADVAISASEFMFEETRNYVKQRK--AFGKTVAHLQTVQHKLAELKTHICVTRAFVDNCL 352
            A  A+ A+           ++R   A G  +A     Q +LAE    I   R  ++   
Sbjct: 2   FAAPALGAARGALAAFIERARERVRAAGGAPLAEDPATQTRLAEAAAEIDAARLLLERAA 61

Query: 353 QLHEAKRLDS--------ATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAKAYVD 404
               A             A A      A+EL  +      +  GG     + P+ + + D
Sbjct: 62  DRIWAHADRGDEVTPEERARARRDAALAAELAIAAVDRLFRAAGGSALFKDSPLQRFWRD 121

Query: 405 ARVQPIYGGTNE 416
           A     +   + 
Sbjct: 122 AHAGAAHAALDP 133


>gnl|CDD|118191 pfam09659, Cas_Csm6, CRISPR-associated protein (Cas_Csm6).
           Clusters of short DNA repeats with nonhomologous
           spacers, which are found at regular intervals in the
           genomes of phylogenetically distinct prokaryotic
           species, comprise a family with recognisable features.
           This family is known as CRISPR (short for Clustered,
           Regularly Interspaced Short Palindromic Repeats). A
           number of protein families appear only in association
           with these repeats and are designated Cas
           (CRISPR-Associated) proteins.
          Length = 362

 Score = 31.7 bits (72), Expect = 0.088
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 8/67 (11%)

Query: 247 KLHKMGLKAQDTAELFFEDIRLPASALLGEENKGF-YYIMKELPQERLLIADVAISAS-- 303
           KLH+  +  +  A+ F          L  +  K   YY++ +L Q R  +AD  I A   
Sbjct: 160 KLHRKNMDLK-EAKKFSRIANFD---LDDDAKKLLEYYLLLDLLQNREQLADFLIGAKSA 215

Query: 304 -EFMFEE 309
            EF+ E 
Sbjct: 216 AEFVLEC 222


>gnl|CDD|111635 pfam02759, RUN, RUN domain.  This domain is present in several
           proteins that are linked to the functions of GTPases in
           the Rap and Rab families. They could hence play
           important roles in multiple Ras-like GTPase signalling
           pathways. The domain is comprises six conserved regions,
           which in some proteins have considerable insertions
           between them. The domain core is thought to take up a
           predominantly alpha fold, with basic amino acids in
           regions A and D possibly playing a functional role in
           interactions with Ras GTPases.
          Length = 133

 Score = 28.5 bits (64), Expect = 0.84
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 318 KAFGKTVAHLQTVQH--KLAELKTHICVTRAFVDNCLQLHEAKRLDS 362
           K      +  + V    +LAE+KT I   RA++   L L+E K L S
Sbjct: 40  KVLPPAESLKRVVSQIEQLAEIKTAIGKGRAWI--RLALNE-KSLSS 83


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0620    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 3,676,581
Number of extensions: 343099
Number of successful extensions: 287
Number of sequences better than  1.0: 1
Number of HSP's gapped: 284
Number of HSP's successfully gapped: 6
Length of query: 430
Length of database: 1,940,249
Length adjustment: 87
Effective length of query: 343
Effective length of database: 1,040,669
Effective search space: 356949467
Effective search space used: 356949467
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (27.9 bits)