New window

ID: GDB3447A_194394174

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB3447A_194394174
         (190 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109209 pfam00143, Interferon, Interferon alpha/beta doma...   285   1e-78
gnl|CDD|109654 pfam00606, Glycoprotein_B, Herpesvirus Glycoprote...    30   0.14 
gnl|CDD|113616 pfam04850, Baculo_E66, Baculovirus E66 occlusion-...    28   0.60 

>gnl|CDD|109209 pfam00143, Interferon, Interferon alpha/beta domain. 
          Length = 167

 Score =  285 bits (732), Expect = 1e-78
 Identities = 120/167 (71%), Positives = 134/167 (80%)

Query: 22  SLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVL 81
           SLGCDLP+ H L NRR L LL QM+RISPSSCL DR DFGFPQE  DG QFQKA AISVL
Sbjct: 1   SLGCDLPQQHRLSNRRCLTLLRQMNRISPSSCLKDRMDFGFPQEMLDGQQFQKAQAISVL 60

Query: 82  HELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSI 141
           HE++QQIFNLF+T+ SSAAW+E LLD   TEL+QQLNDLE C+ QE    E+PL   DS+
Sbjct: 61  HEMLQQIFNLFSTEFSSAAWNETLLDSLLTELHQQLNDLETCLEQEMGEEESPLTREDSL 120

Query: 142 LAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRR 188
           LA+KKYF+RI LYL EKKYSPCAWEVVRAEIMR+ S STNL  RLR 
Sbjct: 121 LALKKYFQRIHLYLKEKKYSPCAWEVVRAEIMRNFSSSTNLTGRLRN 167


>gnl|CDD|109654 pfam00606, Glycoprotein_B, Herpesvirus Glycoprotein B.  This family
           of proteins contains a transmembrane region.
          Length = 716

 Score = 29.6 bits (67), Expect = 0.14
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 26  DLPETHSLDNRRTLMLLAQMSRISPSS 52
            L E       R L L  ++S+I+PS+
Sbjct: 418 RLAEAWCELQNRELTLWHELSKINPSA 444


>gnl|CDD|113616 pfam04850, Baculo_E66, Baculovirus E66 occlusion-derived virus
           envelope protein. 
          Length = 642

 Score = 27.6 bits (62), Expect = 0.60
 Identities = 14/46 (30%), Positives = 19/46 (41%), Gaps = 2/46 (4%)

Query: 29  ETHSL--DNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQF 72
            TH+L  D    L+ L  +   +  SC + R    F      GNQF
Sbjct: 593 HTHTLSFDVIERLLSLISLRIDNLVSCTILRTGDAFVLNNTHGNQF 638


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.322    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0785    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 1,633,685
Number of extensions: 145204
Number of successful extensions: 155
Number of sequences better than  1.0: 1
Number of HSP's gapped: 155
Number of HSP's successfully gapped: 5
Length of query: 190
Length of database: 1,940,249
Length adjustment: 79
Effective length of query: 111
Effective length of database: 1,123,389
Effective search space: 124696179
Effective search space used: 124696179
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 58 (26.0 bits)