New window

ID: GDB3459A_4557880

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB3459A_4557880
         (489 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|115772 pfam07140, IFNGR1, Interferon gamma receptor alph...   779   0.0  
gnl|CDD|118923 pfam10402, IL10Ra-bind, Interleukin-10 receptor a...    45   1e-05
gnl|CDD|113668 pfam04903, Pox_IFNR, Poxvirus interferon gamma re...    42   1e-04
gnl|CDD|111240 pfam02326, YMF19, Plant ATP synthase F0.  This fa...    31   0.21 
gnl|CDD|113865 pfam05110, AF-4, AF-4 proto-oncoprotein.  This fa...    30   0.30 
gnl|CDD|118561 pfam10032, Pho88, Phosphate transporter (Pho88). ...    29   0.58 
gnl|CDD|116312 pfam07698, 7TM-7TMR_HD, 7TM receptor with intrace...    30   0.59 

>gnl|CDD|115772 pfam07140, IFNGR1, Interferon gamma receptor alpha chain (IFNGR1). 
           This family consists of several mammalian interferon
           gamma receptor (IFNGR1) proteins. Molecular interactions
           among cytokines and cytokine receptors form the basis of
           many cell-signaling pathways relevant to immune
           function. Human interferon-gamma (IFN-gamma) signals
           through a multimeric receptor complex consisting of two
           different but structurally related transmembrane chains:
           the high-affinity receptor-binding subunit
           (IFN-gammaRalpha) and a species specific accessory
           factor (AF-1 or IFN-gammaRbeta).
          Length = 467

 Score =  779 bits (2013), Expect = 0.0
 Identities = 335/491 (68%), Positives = 369/491 (75%), Gaps = 26/491 (5%)

Query: 1   MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT 60
           M LL +L L  QG S A M T D GP SVPTPTNV IESYN+NP+VYWEYQ M QVPVFT
Sbjct: 1   MILLVVLMLSAQGGSGALMSTEDPGPPSVPTPTNVLIESYNLNPVVYWEYQNMSQVPVFT 60

Query: 61  VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA 120
           V+VKNY   NSEW DAC NISHHYCNI DH+G P NS W RVKA+VGQKESAYAKSEEFA
Sbjct: 61  VQVKNY---NSEWTDACTNISHHYCNIYDHIGYPDNSAWARVKAKVGQKESAYAKSEEFA 117

Query: 121 VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG 180
           +CR GK+GPP LDIR++EKQ+M+DIFHPSVFVNGDEQE  +   TTCY   Y VYVR N 
Sbjct: 118 MCRKGKVGPPGLDIRRKEKQLMVDIFHPSVFVNGDEQETMFGDGTTCYTFDYTVYVRHNR 177

Query: 181 S-EIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIF 239
           S EI + I T K++DCDE  C+L I VS+LNSQYCVS EGV   W VTTEKSK+VCI IF
Sbjct: 178 SGEILHTIHTVKKEDCDETLCELNISVSTLNSQYCVSVEGVSSFWQVTTEKSKDVCIPIF 237

Query: 240 NSSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETK 299
           +   KGS+WI VVA LL   V+SLVFICFYIKK NP K KSI+LPKSL+SVV+SATLETK
Sbjct: 238 HDDRKGSIWILVVAPLLFLTVVSLVFICFYIKK-NPFKRKSIMLPKSLLSVVKSATLETK 296

Query: 300 PESKYVSLITSYQPFSLEKE-VVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTT 358
           PESKY SL+TSYQP  LEKE V+CEEPLS  TVP     D+P  VE  EELS ITE VT 
Sbjct: 297 PESKY-SLVTSYQPAVLEKETVICEEPLSTVTVP-----DSPEAVEQ-EELSKITEAVTA 349

Query: 359 EENIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSC 418
           E N  DV P S LTPI+RES S LSSNQS  GS +L SYHSRN S+S    NG       
Sbjct: 350 EGNTSDVTPDSPLTPIQRESFSLLSSNQS--GSCSLTSYHSRNGSDSGLVGNG------- 400

Query: 419 LESHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIG 478
               SS+SDSEF PNNK E K  GQE I V KAPTS GYDKPHVLVD+LVDDSGKESLIG
Sbjct: 401 ----SSISDSEFLPNNKSETKMAGQEPIPVRKAPTSSGYDKPHVLVDVLVDDSGKESLIG 456

Query: 479 YRPTEDSKEFS 489
           YR T DS+E S
Sbjct: 457 YRLTGDSQELS 467


>gnl|CDD|118923 pfam10402, IL10Ra-bind, Interleukin-10 receptor alpha chain.
           IL10Ra-bind is the cell-membrane bound receptor for
           interleukin-10, a pleiotropic cytokine produced by
           subsets of activated T cells, B cells, and macrophages,
           with a broad spectrum of immunoregulation and
           anti-inflammatory effects. The activity of IL-10 is
           mediated through its binding with IL10Ra-bind.
          Length = 217

 Score = 44.6 bits (105), Expect = 1e-05
 Identities = 50/217 (23%), Positives = 83/217 (38%), Gaps = 23/217 (10%)

Query: 30  PTPTNVTIESYNMNPIVYWEYQIMPQVPVFT---VEVKNYGVKNSEWIDACINISHHYCN 86
           P+P++V  E+     I++WE   +P     T   V +K YG  +   I  C       C+
Sbjct: 6   PSPSSVWFEAEFFQHILHWEP--IPNQSESTYYEVALKIYGTSSWNDIHICSKAQTLSCD 63

Query: 87  ISDHVGD---PSNSLWVRVKARVGQKESAYAKSE-EFAVCRDG-KIGPPKLDIRKEEKQI 141
           ++ +  D    S     RV+A  G + S + ++   F+V      +    L +       
Sbjct: 64  LTTYTLDLYHSSLGYRARVRAVDGSQYSNWTRTNTRFSVDEVILTVDSVTLKVTDGFIYG 123

Query: 142 MIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQ 201
            I +  P +   GDE E     +   + R Y VY+R        K   QK       Q +
Sbjct: 124 TIQLPRPKLLPAGDEYE-----QIFKHARRYRVYIR--------KFSEQKTYTKWVKQEE 170

Query: 202 LAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITI 238
             + V     ++CV  E  +         S+E C+TI
Sbjct: 171 FTLRVPFWVREFCVKVEPDVASRINKAMWSEEQCLTI 207


>gnl|CDD|113668 pfam04903, Pox_IFNR, Poxvirus interferon gamma receptor. 
          Length = 266

 Score = 41.6 bits (97), Expect = 1e-04
 Identities = 53/213 (24%), Positives = 85/213 (39%), Gaps = 27/213 (12%)

Query: 31  TPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDH 90
             T+   ES N +  + W         ++ + +KNYG+K   W     N+     +IS  
Sbjct: 17  KITSYKFESVNFDSKIEWTGD-----GLYNISLKNYGIKT--WQTMYTNVPEGTYDISAF 69

Query: 91  VGDPSNSLWVRVKARVGQKESAYAKSEEF--AVCRDGKIGPPKLDIRKEEKQIMIDIFHP 148
             +   S WV+        E    K EE+   +C + KIGPP + + + +  I + I HP
Sbjct: 70  PKNDFVSFWVKF-------EQGDYKVEEYCTGLCIEVKIGPPTVTLTEYDDHINLYIEHP 122

Query: 149 SVFVNGDEQEVDYDPETTCYIR-VYNVYVRMNGSE--IQYKILTQKEDDCDEIQCQLAIP 205
                G ++   Y     C I  +Y        SE  + Y I    + DC    C +   
Sbjct: 123 YA-TRGSKKIPIYKRGDMCDIYLLYTANFTFGDSEEPVPYDI---DDYDCTSTGCSIDFA 178

Query: 206 VSSLNSQYCVSAEGVLHVW-GVTTEKSKEVCIT 237
            +    + CV+A+G    +    T  S EVC+T
Sbjct: 179 TT---EKVCVTAQGATEGFLEKITPWSSEVCLT 208


>gnl|CDD|111240 pfam02326, YMF19, Plant ATP synthase F0.  This family corresponds
           to subunit 8 (YMF19) of the F0 complex of plant and
           algae mitochondrial F-ATPases (EC:3.6.1.34).
          Length = 84

 Score = 30.8 bits (70), Expect = 0.21
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 3/56 (5%)

Query: 258 FLVLSLVFICFYI---KKINPLKEKSIILPKSLISVVRSATLETKPESKYVSLITS 310
           F  L L F  FYI     I P   + + L K L+S + S+ L  +     VS  + 
Sbjct: 12  FFWLCLFFFTFYIFLLNFILPKISRILKLRKKLLSSLISSKLGKEQSLLGVSKDSL 67


>gnl|CDD|113865 pfam05110, AF-4, AF-4 proto-oncoprotein.  This family consists of
           AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E mental
           retardation syndrome) nuclear proteins. These proteins
           have been linked to human diseases such as acute
           lymphoblastic leukaemia and mental retardation. The
           family also contains a Drosophila AF4 protein homologue
           Lilliputian which contains an AT-hook domain.
           Lilliputian represents a novel pair-rule gene that acts
           in cytoskeleton regulation, segmentation and
           morphogenesis in Drosophila.
          Length = 1209

 Score = 30.3 bits (68), Expect = 0.30
 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 8/51 (15%)

Query: 379 SSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLESHSSLSDSE 429
           +SP S  QSEP + A +S  S + SES        +DS   ES SS SDSE
Sbjct: 439 NSPQSLPQSEPAASAHSSSGSSSSSESSSG-----SDS---ESESSSSDSE 481


>gnl|CDD|118561 pfam10032, Pho88, Phosphate transporter (Pho88).  Members of this
           family of proteins are involved in inorganic phosphate
           transport, as well as telomere length regulation and
           maintenance.
          Length = 191

 Score = 29.3 bits (66), Expect = 0.58
 Identities = 13/50 (26%), Positives = 20/50 (40%), Gaps = 10/50 (20%)

Query: 239 FNSSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLI 288
               I+  L            V  + F+  Y+K  NPL  +SI+  KS +
Sbjct: 93  LRKLIRSIL----------MGVAMMGFMHLYMKYTNPLLIQSIMPLKSAL 132


>gnl|CDD|116312 pfam07698, 7TM-7TMR_HD, 7TM receptor with intracellular HD
           hydrolase.  These bacterial 7TM receptor proteins have
           an intracellular pfam01966. This entry corresponds to
           the 7 helix transmembrane domain. These proteins also
           contain an N-terminal extracellular domain.
          Length = 189

 Score = 29.5 bits (67), Expect = 0.59
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 248 WIPVVAALLLFLVLSLVFICFYIKKI--NPLKEKSIILPKSLISVV 291
           W+ ++  L L ++L L+    Y+K+     LK++S +L  SL+ V+
Sbjct: 1   WLILLG-LALLVLLLLLIFYLYLKRYEKELLKKRSYLLLLSLLLVL 45


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.314    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0510    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 4,126,448
Number of extensions: 384343
Number of successful extensions: 371
Number of sequences better than  1.0: 1
Number of HSP's gapped: 362
Number of HSP's successfully gapped: 10
Length of query: 489
Length of database: 1,940,249
Length adjustment: 88
Effective length of query: 401
Effective length of database: 1,030,329
Effective search space: 413161929
Effective search space used: 413161929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.6 bits)