New window

ID: GDB440A_168229248

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB440A_168229248
         (561 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109777 pfam00733, Asn_synthase, Asparagine synthase.  Th...   218   7e-58
gnl|CDD|109371 pfam00310, GATase_2, Glutamine amidotransferases ...    96   7e-21
gnl|CDD|115180 pfam06508, ExsB, ExsB.  This family includes puta...    40   5e-04
gnl|CDD|111896 pfam03054, tRNA_Me_trans, tRNA methyl transferase...    38   0.001
gnl|CDD|117945 pfam09404, DUF2003, Eukaryotic protein of unknown...    30   0.45 
gnl|CDD|111440 pfam02540, NAD_synthase, NAD synthase.  NAD synth...    29   0.92 

>gnl|CDD|109777 pfam00733, Asn_synthase, Asparagine synthase.  This family is
           always found associated with pfam00310. Members of this
           family catalyse the conversion of aspartate to
           asparagine.
          Length = 195

 Score =  218 bits (558), Expect = 7e-58
 Identities = 98/235 (41%), Positives = 135/235 (57%), Gaps = 43/235 (18%)

Query: 235 LRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSP 294
           LR L  +AVK+RL  D  +G LLSGGLDSSL+AA   +Q        PL+TF++G E S 
Sbjct: 2   LRELLRDAVKRRLRADVPVGVLLSGGLDSSLIAALAARQSSP-----PLKTFSVGFEGSD 56

Query: 295 --DLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYI 352
             +   A  VADH+G++H+E++   EE + AL EVI+ LE        +++ +YL+S+  
Sbjct: 57  YDEAPYAELVADHLGTDHHEIIVTEEELLDALPEVIYHLEEPFG--DSSAIPLYLLSRLA 114

Query: 353 RKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAH 412
           RK     V+ SGEG+DEL  GY                             R DR + AH
Sbjct: 115 RK--GVKVVLSGEGADELFGGY-----------------------------RDDRMSMAH 143

Query: 413 GLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPK 467
           GLE+RVPFLDHR   + LSLPPE+++ ++G EK++LRE      ++P EILWRPK
Sbjct: 144 GLEVRVPFLDHRLVEFALSLPPELKL-RDGEEKYILREAARG--ILPDEILWRPK 195


>gnl|CDD|109371 pfam00310, GATase_2, Glutamine amidotransferases class-II. 
          Length = 222

 Score = 95.9 bits (239), Expect = 7e-21
 Identities = 40/237 (16%), Positives = 58/237 (24%), Gaps = 92/237 (38%)

Query: 2   CGIWALF------GSDDCLSVQCLSAMKIAHRG----------------PDAFRFENVNG 39
           CGI           S D +     +  ++ HRG                PD F   +   
Sbjct: 1   CGILGFIAHIKGKASHDVVEDALEALERLEHRGGVGADGNDGAGILTQIPDGFGAPS--- 57

Query: 40  YTNCCFGFHRLAVVDPLFGMQPIRVKKY-------------------------------- 67
                    R   V      + I  +                                  
Sbjct: 58  --------ERRLFVIRKRIEKSIVAENVQDERFKSALAIVHTRFSTNGFPSWENAQPFRR 109

Query: 68  PYLWLCYNGEIYNHK----KMQQH----------------FEFEYQTKVD---GEIILHL 104
               L +NGEI   +     M+                   E   +              
Sbjct: 110 EGWVLAHNGEINTLRGLRNWMRAREGKFQSGSDSEALDNLLELLLRAGRSPDMDPEERAF 169

Query: 105 YDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEA 161
           Y+   +   +   DG  A V  D   + V    D  G+RP    +TEDG + V SEA
Sbjct: 170 YEY--LAGLMEPWDGPAALVFTD--GRYVGATLDRNGLRPARYGITEDGLIVVASEA 222


>gnl|CDD|115180 pfam06508, ExsB, ExsB.  This family includes putative
           transcriptional regulators from Bacteria and Archaea.
          Length = 174

 Score = 39.9 bits (94), Expect = 5e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 255 CLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEV 313
            L SGG DS+   A   K+  E    Y L TF  G   S +L  A+K+A  +G +H  +
Sbjct: 4   VLFSGGQDSTTCLAWAKKEGYEV---YAL-TFDYGQRHSKELECAKKIAKKLGVKHKIL 58


>gnl|CDD|111896 pfam03054, tRNA_Me_trans, tRNA methyl transferase.  This family
           represents
           tRNA(5-methylaminomethyl-2-thiouridine)-
           methyltransferase which is involved in the biosynthesis
           of the modified nucleoside
           5-methylaminomethyl-2-thiouridine present in the wobble
           position of some tRNAs.
          Length = 355

 Score = 38.4 bits (90), Expect = 0.001
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 21/78 (26%)

Query: 251 RRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGM-----EDSP--------DLL 297
            ++   +SGG+DSS VAA LLK+      Q   +   + M     ED          DL 
Sbjct: 1   MKVVVAMSGGVDSS-VAAYLLKE------QGY-EVIGVFMKNWDEEDEEGHGCCSEEDLA 52

Query: 298 AARKVADHIGSEHYEVLF 315
            A++V + +G   Y V F
Sbjct: 53  DAQRVCEQLGIPLYVVNF 70


>gnl|CDD|117945 pfam09404, DUF2003, Eukaryotic protein of unknown function
           (DUF2003).  This is a family of proteins of unknown
           function which adopt an alpha helical and beta sheet
           structure.
          Length = 447

 Score = 30.0 bits (67), Expect = 0.45
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 15/100 (15%)

Query: 348 ISKYIRKNTDSVV--IFSGEGSDELTQGYIYFHKAP---SPEKAEE--------ESERLL 394
           IS +IRK   S V  +F   GS E  QG+ Y H      +P+  ++          ER +
Sbjct: 302 ISSFIRKYDASNVSLVFDNRGS-ESFQGHGYHHPHSYREAPKGVDQFPAVVSLPSGERPV 360

Query: 395 RELYLFDVLRADRTTAAHGLELRVPFLDHRF-SSYYLSLP 433
                  ++  DRT+  + LE  V F D +  S+Y+L+ P
Sbjct: 361 THWPNVIMIMTDRTSELNTLEKVVHFYDDKVQSTYFLTRP 400


>gnl|CDD|111440 pfam02540, NAD_synthase, NAD synthase.  NAD synthase (EC:6.3.5.1)
           is involved in the de novo synthesis of NAD and is
           induced by stress factors such as heat shock and glucose
           limitation.
          Length = 242

 Score = 28.9 bits (65), Expect = 0.92
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 257 LSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGM----EDSPDLLAARKVADHIGSEHYE 312
           LSGG+DS++VA   +K L +  V       A+ M        D+  A  +A+++G  +  
Sbjct: 25  LSGGIDSAVVAYLAVKALGKENV------LALIMPSINSSEEDVQDALALAENLGINYKT 78

Query: 313 V 313
           +
Sbjct: 79  I 79


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.322    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0572    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 4,957,193
Number of extensions: 484443
Number of successful extensions: 435
Number of sequences better than  1.0: 1
Number of HSP's gapped: 425
Number of HSP's successfully gapped: 9
Length of query: 561
Length of database: 1,940,249
Length adjustment: 89
Effective length of query: 472
Effective length of database: 1,019,989
Effective search space: 481434808
Effective search space used: 481434808
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.4 bits)