New window

ID: GDB79716A_47155554

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB79716A_47155554
         (523 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109921 pfam00883, Peptidase_M17, Cytosol aminopeptidase ...   308   6e-85
gnl|CDD|111291 pfam02382, RTX, RTX N-terminal domain.  The RTX f...    33   0.050
gnl|CDD|115316 pfam06648, DUF1160, Protein of unknown function (...    31   0.14 
gnl|CDD|109208 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster ...    30   0.37 

>gnl|CDD|109921 pfam00883, Peptidase_M17, Cytosol aminopeptidase family, catalytic
           domain.  The two associated zinc ions and the active
           site are entirely enclosed within the C-terminal
           catalytic domain in leucine aminopeptidase.
          Length = 311

 Score =  308 bits (791), Expect = 6e-85
 Identities = 119/314 (37%), Positives = 171/314 (54%), Gaps = 13/314 (4%)

Query: 178 VRLAARIVDTPCNEMNTDTFLEEINKVGKELGIIP-TIIRDEELKTRGFGGIYGVGKAAL 236
           V LA  +V+TP N +      EE  K+      +   ++ +EEL+  G GG+  V K + 
Sbjct: 1   VNLARDLVNTPANILTPAVLAEEAEKLASNYSDVKIEVLDEEELEELGMGGLLAVNKGSE 60

Query: 237 HPPALAVLSH--TPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAF 294
           +PP   VLS+        + +A VGKGI +D+GG+SIK    M  MK D GGAAAVLGA 
Sbjct: 61  NPPRFIVLSYKGNKSEDKKKLALVGKGITFDSGGISIKPGAGMDLMKYDMGGAAAVLGAI 120

Query: 295 RAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVS 354
           +A  +     N+ AV  L EN +   A RP DI    +GKTVE+NNTDAEGRLVLAD ++
Sbjct: 121 KALAQLKPPVNVVAVLALTENMISGTAMRPGDIITAMNGKTVEVNNTDAEGRLVLADALT 180

Query: 355 YACKDLGADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYC 414
           YAC+ L  ++I+D+ATLTGA  +A G  +  + +N  E     +KA  + G+ V  +   
Sbjct: 181 YACE-LNPEVIIDVATLTGACVVALGTTYTGIFSNDDELANELIKAAEESGEKVWRMPLH 239

Query: 415 PELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGER 474
            + +  +  S +AD+ N +  R  + +  A LF+   +    P  W HLDIA      ++
Sbjct: 240 ED-YKKQLKSKIADLAN-IGGRRGAGAITAALFLKEFVEDGVP--WAHLDIAGTAWNKKK 295

Query: 475 -----ATGFGVALL 483
                ATG+GV  L
Sbjct: 296 GQPKGATGYGVRTL 309


>gnl|CDD|111291 pfam02382, RTX, RTX N-terminal domain.  The RTX family of bacterial
           toxins are a group of cytolysins and cytotoxins. This
           Pfam family represents the N-terminal domain which is
           found in association with a glycine-rich repeat domain
           and hemolysinCabind pfam00353.
          Length = 653

 Score = 33.2 bits (76), Expect = 0.050
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 155 LVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNT-DTFLEEINKVGKELGIIP 212
           L  + NG   VS L+ LA A  G+ L   +VD   +  NT D F E++NK+G +L  + 
Sbjct: 163 LKNRRNGG-NVSQLE-LAKA--GLELINELVDNIASSTNTVDAFSEQLNKLGSKLQNVK 217


>gnl|CDD|115316 pfam06648, DUF1160, Protein of unknown function (DUF1160).  This
           family consists of several hypothetical Baculovirus
           proteins of unknown function.
          Length = 122

 Score = 31.4 bits (72), Expect = 0.14
 Identities = 13/51 (25%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 143 RLEKKTVTV-EFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEM 192
               K VTV + F+  +    + V  +  + +A DG +L    +D  CN++
Sbjct: 34  TFRDKLVTVLKMFIDRK----ITVEDVCNIVDAVDGSKLTKSQIDYLCNQV 80


>gnl|CDD|109208 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster binding proteins,
           NifH/frxC family. 
          Length = 270

 Score = 30.0 bits (68), Expect = 0.37
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 6/47 (12%)

Query: 177 GVRLAARIVDTPCNEMNTDTFLEEINKVGKELG--IIPTIIRDEELK 221
           GVRL   I    CN    D   E I+   + LG  +I  + RD  ++
Sbjct: 174 GVRLGGLI----CNSRKVDDERELIDAFAEALGTQMIHFVPRDNIVQ 216


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.320    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0765    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 4,377,394
Number of extensions: 407836
Number of successful extensions: 351
Number of sequences better than  1.0: 1
Number of HSP's gapped: 345
Number of HSP's successfully gapped: 5
Length of query: 523
Length of database: 1,940,249
Length adjustment: 88
Effective length of query: 435
Effective length of database: 1,030,329
Effective search space: 448193115
Effective search space used: 448193115
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.0 bits)