New window

ID: GDB79781A_40255052

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB79781A_40255052
         (822 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109073 pfam00004, AAA, ATPase family associated with var...    87   5e-18
gnl|CDD|110977 pfam02029, Caldesmon, Caldesmon.                        37   0.005
gnl|CDD|116794 pfam08208, RNA_polI_A34, DNA-directed RNA polymer...    37   0.006
gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor ...    36   0.012
gnl|CDD|114515 pfam05793, TFIIF_alpha, Transcription initiation ...    36   0.013
gnl|CDD|118767 pfam10243, MIP-T3, Microtubule-binding protein MI...    36   0.015
gnl|CDD|117009 pfam08432, DUF1742, Fungal protein of unknown fun...    35   0.017
gnl|CDD|115185 pfam06513, DUF1103, Repeat of unknown function (D...    35   0.022
gnl|CDD|117171 pfam08597, eIF3_subunit, Translation initiation f...    35   0.027
gnl|CDD|118802 pfam10278, Med19, Mediator of RNA pol II transcri...    34   0.041
gnl|CDD|111369 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain...    34   0.042
gnl|CDD|115191 pfam06519, TolA, TolA protein.  This family consi...    34   0.049
gnl|CDD|115324 pfam06658, DUF1168, Protein of unknown function (...    34   0.052
gnl|CDD|116556 pfam07946, DUF1682, Protein of unknown function (...    33   0.056
gnl|CDD|118043 pfam09507, CDC27, DNA polymerase subunit Cdc27.  ...    34   0.060
gnl|CDD|118005 pfam09468, RNase_H2-Ydr279, Ydr279p protein famil...    33   0.068
gnl|CDD|117073 pfam08496, Peptidase_S49_N, Peptidase family S49 ...    33   0.089
gnl|CDD|116955 pfam08374, Protocadherin, Protocadherin.  The str...    32   0.22 
gnl|CDD|115800 pfam07169, Triadin, Triadin.  This family consist...    31   0.25 
gnl|CDD|116385 pfam07771, TSGP1, Tick salivary peptide group 1. ...    31   0.28 
gnl|CDD|117151 pfam08576, DUF1764, Eukaryotic protein of unknown...    30   0.52 
gnl|CDD|117636 pfam09073, BUD22, BUD22.  BUD22 has been shown in...    30   0.63 
gnl|CDD|114487 pfam05764, YL1, YL1 nuclear protein.  The protein...    30   0.68 
gnl|CDD|110124 pfam01101, HMG14_17, HMG14 and HMG17.                   30   0.69 
gnl|CDD|109660 pfam00612, IQ, IQ calmodulin-binding motif.  Calm...    30   0.70 
gnl|CDD|111770 pfam02919, Topoisom_I_N, Eukaryotic DNA topoisome...    30   0.95 

>gnl|CDD|109073 pfam00004, AAA, ATPase family associated with various cellular
           activities (AAA).  AAA family proteins often perform
           chaperone-like functions that assist in the assembly,
           operation, or disassembly of protein complexes.
          Length = 185

 Score = 86.6 bits (215), Expect = 5e-18
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 13/186 (6%)

Query: 570 SLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQ 629
            LLL GP G GK  L  A+  E GA    +S S +  KY G++     + A+F +A++  
Sbjct: 1   GLLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELLSKYVGESE--KRVRALFSLAKKSA 58

Query: 630 PSVVWIEDTEKTFYKKVPNAEKMNEP--KRLKKHLPQILKLLKPDDRILIVGTTRRPF-- 685
           P V++I++          +          R+   L   +   +    ++++G T RP   
Sbjct: 59  PCVIFIDE----IDALAGSRGDGEGDVSSRVVNQLLTEMDGFEKHSNVIVIGATNRPDLL 114

Query: 686 DAELQSFCKVYQKIILVPRPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGH 745
           D  L      + + I VP PD   R  + K  +++    L   +++  LA+ T G++   
Sbjct: 115 DPALLRP-GRFDRRIEVPLPDEEERLEILKIHLKK--LPLEKDVDLDELARRTPGYSGAD 171

Query: 746 IVEVVK 751
           +  + +
Sbjct: 172 LAALCR 177


>gnl|CDD|110977 pfam02029, Caldesmon, Caldesmon. 
          Length = 806

 Score = 37.2 bits (85), Expect = 0.005
 Identities = 34/167 (20%), Positives = 77/167 (46%), Gaps = 6/167 (3%)

Query: 345 NQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKE 404
           ++E  E  + K + +EK+  KA++ KK   EK K E E+   +      A +E   A + 
Sbjct: 263 DKERAEAERAKLEAEEKERIKAEEDKKAADEKAKAEAEEKAAAERERAKAEEEKRAAEER 322

Query: 405 IWMKKDESWNFSQDYD----PELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERE 460
              K +E    +++ +     E     + + +  E +   +E  + E +  + A +R + 
Sbjct: 323 ERAKAEEERKAAEERERAKAEEERAAAEEQAIAEEEKKAAEERAKAEEEEKRAAEERAKA 382

Query: 461 RPVKAGKKKDKKGKKGKKKEKK--AKKDKDLTADRTIESLYKELVEE 505
              +  K   ++ ++ K +E+K  A+++  + A++  E +  + +EE
Sbjct: 383 EAEEEEKAAAEEQERAKAEEEKKAAEEEAKIEAEKLEEKIEGKKMEE 429


>gnl|CDD|116794 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit
           RPA34.5.  This is a family of proteins conserved from
           yeasts to human. Subunit A34.5 of RNA polymerase I is a
           non-essential subunit which is thought to help Pol I
           overcome topological constraints imposed on ribosomal
           DNA during the process of transcription.
          Length = 192

 Score = 37.0 bits (86), Expect = 0.006
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 316 PDYPDVEEGGSAIIFSDKTIQQVIEDIIANQEEEEKNKKKKK--KKEKQPKKAKKQKKGT 373
           PDYP  E G  +     +T  +V ++    +EEE+K KKKKK  KKEK+ KK KK+K   
Sbjct: 120 PDYPPSESGSESETSEKETTAKVEKEA-EVEEEEKKEKKKKKEVKKEKKEKKDKKEKMKE 178

Query: 374 KEKNKEEDEK 383
            +++K++ +K
Sbjct: 179 PKESKKKKKK 188



 Score = 31.6 bits (72), Expect = 0.25
 Identities = 18/37 (48%), Positives = 23/37 (62%)

Query: 452 KLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDKD 488
           +     E+E  V+  +KK+KK KK  KKEKK KKDK 
Sbjct: 137 ETTAKVEKEAEVEEEEKKEKKKKKEVKKEKKEKKDKK 173



 Score = 30.4 bits (69), Expect = 0.54
 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 347 EEEEKNKKKKKKKE--KQPKKAKKQKKGTKEKNKEEDEKWK 385
           +E E  +++KK+K+  K+ KK KK+KK  KEK KE  E  K
Sbjct: 144 KEAEVEEEEKKEKKKKKEVKKEKKEKKDKKEKMKEPKESKK 184


>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR).  This
           family consists of several bovine specific leukaemia
           virus receptors which are thought to function as
           transmembrane proteins, although their exact function is
           unknown.
          Length = 561

 Score = 35.8 bits (82), Expect = 0.012
 Identities = 35/148 (23%), Positives = 55/148 (37%), Gaps = 31/148 (20%)

Query: 350 EKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWMKK 409
           EK  KK KKKEK+ K+ ++ K   KE    +     +  S   PA         E  +  
Sbjct: 196 EKKSKKPKKKEKKEKEKERDKDKKKEVEGFKSLLLALDDS---PASAASVAEADEASLAN 252

Query: 410 DESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKK 469
             S   + D +P+  K+ + +E +                           +  K  KKK
Sbjct: 253 TVSGT-APDSEPDEPKDAEAEETK---------------------------KSPKHKKKK 284

Query: 470 DKKGKKGKKKEKKAKKDKDLTADRTIES 497
            +K K+ KKK+KK    +   +D   E 
Sbjct: 285 QRKEKEEKKKKKKHHHHRCHHSDGGAEQ 312



 Score = 35.0 bits (80), Expect = 0.019
 Identities = 33/147 (22%), Positives = 53/147 (36%), Gaps = 22/147 (14%)

Query: 360 EKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDY 419
           EK+ KK KK++K  KEK +++D+K                       ++  +S   + D 
Sbjct: 196 EKKSKKPKKKEKKEKEKERDKDKK---------------------KEVEGFKSLLLALDD 234

Query: 420 DPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKGKK-GKK 478
            P         +  S            E    K A   E ++  K  KKK +K K+  KK
Sbjct: 235 SPASAASVAEADEASLANTVSGTAPDSEPDEPKDAEAEETKKSPKHKKKKQRKEKEEKKK 294

Query: 479 KEKKAKKDKDLTADRTIESLYKELVEE 505
           K+K        +     + +    VEE
Sbjct: 295 KKKHHHHRCHHSDGGAEQPVQNGAVEE 321



 Score = 34.7 bits (79), Expect = 0.025
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 15/145 (10%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNK---EEDEKWKMSPSLFLPAMKEGCNAYK 403
           EEE +++++ +K +++ KK +K+K+G +  +    E DE   ++P+  +  + E      
Sbjct: 85  EEERRHRQRLEKDKREKKKREKEKRGRRRHHSLGTESDE--DIAPAQMVDIVTE---EMP 139

Query: 404 EIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPV 463
           E  +  DE      D DP         +L   +    ++L  Q+ +N + +   E+   V
Sbjct: 140 ENALPSDED-----DKDPNDPYRALDIDLDKPL-ADSEKLPVQKHRNAETSKSPEKG-DV 192

Query: 464 KAGKKKDKKGKKGKKKEKKAKKDKD 488
            A +KK KK KK +KKEK+ ++DKD
Sbjct: 193 PAVEKKSKKPKKKEKKEKEKERDKD 217


>gnl|CDD|114515 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha
           subunit (TFIIF-alpha).  Transcription initiation factor
           IIF, alpha subunit (TFIIF-alpha) or RNA polymerase
           II-associating protein 74 (RAP74) is the large subunit
           of transcription factor IIF (TFIIF), which is essential
           for accurate initiation and stimulates elongation by RNA
           polymerase II.
          Length = 521

 Score = 35.7 bits (82), Expect = 0.013
 Identities = 26/155 (16%), Positives = 61/155 (39%), Gaps = 18/155 (11%)

Query: 343 IANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAY 402
             + +EE+ + + + + E++    KK+KK   +K  ++ ++ +               A+
Sbjct: 214 EGSDDEEDSSDESEGEDEEEEASRKKKKKLNAKKGDDKKKRKEDGDDE----------AF 263

Query: 403 KEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERP 462
           +E      +     +DY  +   +      + + ++  +    + +K      D + E  
Sbjct: 264 EES--DDGDDEGREEDYTSDSEADSDD-PEERKDKLAPEIPAPKLVK-----QDEDDEEN 315

Query: 463 VKAGKKKDKKGKKGKKKEKKAKKDKDLTADRTIES 497
            +     +K G++ KK + KA  DK    D   ES
Sbjct: 316 SEEEDGLEKSGEELKKLKGKAPGDKKKDKDDDDES 350


>gnl|CDD|118767 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3.  This
           protein, which interacts with both microtubules and
           TRAF3 (tumour necrosis factor receptor-associated factor
           3), is conserved from worms to humans. The N-terminal
           region is the microtubule binding domain and is
           well-conserved; the C-terminal 100 residues, also
           well-conserved, constitute the coiled-coil region which
           binds to TRAF3. The central region of the protein is
           rich in lysine and glutamic acid and carries KKE motifs
           which may also be necessary for tubulin-binding, but
           this region is the least well-conserved.
          Length = 504

 Score = 35.6 bits (82), Expect = 0.015
 Identities = 27/147 (18%), Positives = 64/147 (43%), Gaps = 5/147 (3%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKE-----KNKEEDEKWKMSPSLFLPAMKEGCNA 401
           E++++ KKKKK+K ++ KK +K K+  +E     + +++ EK K +P       +     
Sbjct: 111 EKKKEEKKKKKEKPQEEKKKRKPKEEAEEPRPPKEKEKDKEKKKKAPKDREKESERKEEK 170

Query: 402 YKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERER 461
            K       +    ++  +P   +++K+ E +       +E + +E +           R
Sbjct: 171 EKSREKSPKKKDPKNEKKEPPEKEKKKQAERKQVSGKTPEEDVNEEEEKPDDEGKDRETR 230

Query: 462 PVKAGKKKDKKGKKGKKKEKKAKKDKD 488
                + + KK ++  ++   + K +D
Sbjct: 231 TSPEEEPESKKSEEKSRESPGSLKKED 257



 Score = 35.3 bits (81), Expect = 0.017
 Identities = 34/142 (23%), Positives = 71/142 (50%), Gaps = 8/142 (5%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIW 406
           E+E KN+  ++K+ K+ KK +++KK  KEK +EE +K K       P   +     KE  
Sbjct: 95  EQEPKNRSGREKEAKKEKKKEEKKKK-KEKPQEEKKKRKPKEEAEEPRPPKEKEKDKE-- 151

Query: 407 MKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAG 466
            KK ++    +D + E  ++E++++ + +   + D    ++    K    ++ ER   +G
Sbjct: 152 -KKKKA---PKDREKESERKEEKEKSREKSPKKKDPKNEKKEPPEK-EKKKQAERKQVSG 206

Query: 467 KKKDKKGKKGKKKEKKAKKDKD 488
           K  ++   + ++K     KD++
Sbjct: 207 KTPEEDVNEEEEKPDDEGKDRE 228



 Score = 31.4 bits (71), Expect = 0.23
 Identities = 39/143 (27%), Positives = 53/143 (37%), Gaps = 34/143 (23%)

Query: 349 EEKNKKKKKKKEKQPKKAKKQKKGT-KEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWM 407
           + K K  K K E++PK    ++K   KEK KEE +K K  P                   
Sbjct: 84  DSKGKAAKTKPEQEPKNRSGREKEAKKEKKKEEKKKKKEKPQ------------------ 125

Query: 408 KKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGK 467
                         E  K+ K KE   E R    E  + + K  K   DRE+E   K  K
Sbjct: 126 --------------EEKKKRKPKEEAEEPRPP-KEKEKDKEKKKKAPKDREKESERKEEK 170

Query: 468 KKDKKGKKGKKKEKKAKKDKDLT 490
           +K ++    KK  K  KK+    
Sbjct: 171 EKSREKSPKKKDPKNEKKEPPEK 193



 Score = 30.2 bits (68), Expect = 0.58
 Identities = 25/163 (15%), Positives = 62/163 (38%), Gaps = 12/163 (7%)

Query: 332 DKTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLF 391
            +  ++  E+    +E+E+  +KKKK  + + K+++++++  K + K   +K   +    
Sbjct: 130 KRKPKEEAEEPRPPKEKEKDKEKKKKAPKDREKESERKEEKEKSREKSPKKKDPKNEKKE 189

Query: 392 LPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNL 451
            P  ++     K+   K+       +D + E  K +   + +       +E   ++    
Sbjct: 190 PPEKEKK----KQAERKQVSGKTPEEDVNEEEEKPDDEGKDRETRTSPEEEPESKK---- 241

Query: 452 KLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDKDLTADRT 494
                 E+ R      KK+   K  +       + +  T  R 
Sbjct: 242 ----SEEKSRESPGSLKKEDPPKSLETPAVVTIQVRIPTESRP 280


>gnl|CDD|117009 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742).
           This is a family of fungal proteins of unknown function.
          Length = 182

 Score = 35.1 bits (81), Expect = 0.017
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 340 EDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEK 383
           E+I   ++E E+ +  K +K    K+  K KK  K+K+K++DEK
Sbjct: 69  EEIEKVKKEYEEKQDGKVEKIASKKEKDKDKKKEKDKDKDKDEK 112



 Score = 32.5 bits (74), Expect = 0.13
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 339 IEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKG-TKEKNKEEDEK 383
           IE +    EE++  K +K   +K+  K KK++K   K+K+++  EK
Sbjct: 71  IEKVKKEYEEKQDGKVEKIASKKEKDKDKKKEKDKDKDKDEKSKEK 116



 Score = 30.5 bits (69), Expect = 0.43
 Identities = 15/59 (25%), Positives = 23/59 (38%)

Query: 345 NQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYK 403
            +   +K K K KKKEK   K K +K   KE++++             P  +     Y 
Sbjct: 87  EKIASKKEKDKDKKKEKDKDKDKDEKSKEKERDEKILRLQYERELDKEPESEPKPRKYT 145


>gnl|CDD|115185 pfam06513, DUF1103, Repeat of unknown function (DUF1103).  This
           family consists of several repeats of around 30 residues
           in length which are found specifically in
           mature-parasite-infected erythrocyte surface antigen
           proteins from Plasmodium falciparum. This family often
           found in conjunction with pfam00226.
          Length = 215

 Score = 34.8 bits (79), Expect = 0.022
 Identities = 29/103 (28%), Positives = 56/103 (54%), Gaps = 1/103 (0%)

Query: 340 EDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGC 399
           +D +   E+ +K  K+K +K  + K  KK KKG KE + E ++K K  P + +  +KE  
Sbjct: 19  KDKVIGSEKTQKEIKEKVEKRVKEKCKKKVKKGIKENDTEGNDKVK-GPEIIIEEVKEEI 77

Query: 400 NAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDE 442
               E  +K++++    +   PE+I EE ++E++ ++   + E
Sbjct: 78  KKQVEDGIKENDTEGNDKVKGPEIITEEVKEEIKKQVEDGIKE 120


>gnl|CDD|117171 pfam08597, eIF3_subunit, Translation initiation factor eIF3
           subunit.  This is a family of proteins which are
           subunits of the eukaryotic translation initiation factor
           3 (eIF3). In yeast it is called Hcr1. The Saccharomyces
           cerevisiae protein eIF3j has been shown to be required
           for processing of 20S pre-rRNA and binds to 18S rRNA and
           eIF3 subunits Rpg1p and Prt1p.
          Length = 241

 Score = 34.6 bits (80), Expect = 0.027
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEK 383
           EE+E+ +++K KK  + K  K  K   +EK K + EK
Sbjct: 40  EEDEEKEEEKAKKAAKAKAKKALKAKIEEKEKAKREK 76



 Score = 31.9 bits (73), Expect = 0.19
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 346 QEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEK 383
           ++EEEK KK  K K K+  KAK ++K   ++ K+E   
Sbjct: 44  EKEEEKAKKAAKAKAKKALKAKIEEKEKAKREKKEKLL 81



 Score = 30.0 bits (68), Expect = 0.65
 Identities = 13/61 (21%), Positives = 22/61 (36%), Gaps = 11/61 (18%)

Query: 440 VDELMRQELKNLKLAVDR-----------ERERPVKAGKKKDKKGKKGKKKEKKAKKDKD 488
           +++L+R    +L     +           E+ +  KA K   KK  K K K      + D
Sbjct: 163 LEDLIRDLCASLSSEDIKKVSSTLNVLINEKLKAEKAAKGGKKKKGKAKAKLNVGGANDD 222

Query: 489 L 489
            
Sbjct: 223 D 223



 Score = 29.6 bits (67), Expect = 0.78
 Identities = 11/37 (29%), Positives = 21/37 (56%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEK 383
           E+EEK ++K KK  K   K   + K  +++  + ++K
Sbjct: 41  EDEEKEEEKAKKAAKAKAKKALKAKIEEKEKAKREKK 77


>gnl|CDD|118802 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19. 
           Med19 represents a family of conserved proteins which
           are members of the multi-protein co-activator Mediator
           complex. Mediator is required for activation of RNA
           polymerase II transcription by DNA binding
           transactivators.
          Length = 181

 Score = 34.1 bits (78), Expect = 0.041
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 344 ANQEEEEKNKKKKKKKEKQPKKAKKQK-KGTKEKNKEED 381
              E EEK  KK+KKKE   ++ K++K K  K+K    +
Sbjct: 137 DGLETEEKKHKKQKKKEDDKERKKRKKEKKRKKKRHSPE 175



 Score = 33.3 bits (76), Expect = 0.072
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDE 382
           EE++  K+KKK+ +K+ KK KK+KK  K+++  E  
Sbjct: 142 EEKKHKKQKKKEDDKERKKRKKEKKRKKKRHSPEHP 177



 Score = 31.0 bits (70), Expect = 0.31
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 344 ANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNK 378
            +  E E+ K KK+KK++  K+ KK+KK  K K K
Sbjct: 136 FDGLETEEKKHKKQKKKEDDKERKKRKKEKKRKKK 170


>gnl|CDD|111369 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain.  This domain is
           found at the N terminus of SMC proteins. The SMC
           (structural maintenance of chromosomes) superfamily
           proteins have ATP-binding domains at the N- and
           C-termini, and two extended coiled-coil domains
           separated by a hinge in the middle. The eukaryotic SMC
           proteins form two kind of heterodimers: the SMC1/SMC3
           and the SMC2/SMC4 types. These heterodimers constitute
           an essential part of higher order complexes, which are
           involved in chromatin and DNA dynamics. This family also
           includes the RecF and RecN proteins that are involved in
           DNA metabolism and recombination.
          Length = 1127

 Score = 34.0 bits (78), Expect = 0.042
 Identities = 24/175 (13%), Positives = 66/175 (37%), Gaps = 14/175 (8%)

Query: 332 DKTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWK--MSPS 389
           +K I+++  ++   + + E+ + + +K   + +  K++     ++   ++E+      P 
Sbjct: 674 EKLIRKLEGELEELRSKIEELELRLEKLRGELESLKEELLELNQQIAAKEEELAKLKQPR 733

Query: 390 LFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELK 449
           + L    E      E   ++                EE+ +EL+ +I     EL     K
Sbjct: 734 ISLLEKLEDLEKELEELGEELNK------------LEERLEELKKKIGRIRRELKELRQK 781

Query: 450 NLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDKDLTADRTIESLYKELVE 504
              L  +  + +       +  K     + E  + K++     + ++ L +++ E
Sbjct: 782 LENLEKEINKLQAELDSLLRALKELSNLQSEIASLKEEIKELKKELKKLEEQIEE 836



 Score = 32.1 bits (73), Expect = 0.16
 Identities = 33/205 (16%), Positives = 85/205 (41%), Gaps = 7/205 (3%)

Query: 330 FSDKTIQQVIEDIIANQEEEEKNKKK---KKKKEKQPKKAKKQKKGTKEKNKEEDEKWKM 386
                ++++ + +   ++E  + KKK    +K+++Q +K ++  K   ++ K + E+ K 
Sbjct: 310 HLISKLKKLEKRLEELKKEISELKKKLEELEKEKEQLEKEREALKERIDELKSKSERDKA 369

Query: 387 SPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQ 446
                   + +     ++    ++E    ++        +++ +EL+ E+  +  E+  +
Sbjct: 370 LQEELEKELAQLDELNEQKSELQEELEELNRLKKRLEDLKQRLEELKEELEKKESEI--E 427

Query: 447 ELKNLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDKDLTADRTIESLYKELV--E 504
           EL+     + +E ++     K+ +K+  + + + +  KK+ +    +  E L        
Sbjct: 428 ELQEELEELKKELDKLKSELKELEKELAELQSELENLKKELNKERRKLEELLSSLSANQS 487

Query: 505 EGLLIQALKVNLSDYIGEYSYLGTT 529
           E    Q  K NL    G    LG  
Sbjct: 488 EAKREQKKKGNLPGVYGRLGELGQV 512


>gnl|CDD|115191 pfam06519, TolA, TolA protein.  This family consists of several
           bacterial TolA proteins as well as two eukaryotic
           proteins of unknown function. Tol proteins are involved
           in the translocation of group A colicins. Colicins are
           bacterial protein toxins, which are active against
           Escherichia coli and other related species (See
           pfam01024). TolA is anchored to the cytoplasmic membrane
           by a single membrane spanning segment near the
           N-terminus, leaving most of the protein exposed to the
           periplasm.
          Length = 385

 Score = 33.8 bits (77), Expect = 0.049
 Identities = 27/154 (17%), Positives = 63/154 (40%), Gaps = 1/154 (0%)

Query: 340 EDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGC 399
           E     Q + E+ ++K+  ++++ K+ ++++   +E  K+ +E  K +      A +   
Sbjct: 76  ERKKKLQRQAEELEQKRAAEQERLKELEEERLQAQEAAKQAEEARKQALEQQKQAEEAKA 135

Query: 400 NAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRER 459
              KE   K +      ++         K+ E +++ +   +   + E K       ++ 
Sbjct: 136 KQAKEAKAKAEAEAKAKEEERKAAAAAAKKAEEEAKAKAAAEAKAKAEAKAAAAEAKKKA 195

Query: 460 ERPVKAGKKKDKKGKKGKKKEK-KAKKDKDLTAD 492
           E   KA  + + K K  K + K KA+ +    A 
Sbjct: 196 EAEAKAAAEAEAKAKAEKAEAKAKAEAEAKEKAA 229



 Score = 32.7 bits (74), Expect = 0.12
 Identities = 26/160 (16%), Positives = 61/160 (38%), Gaps = 5/160 (3%)

Query: 333 KTIQQVIEDIIANQEEEEKN----KKKKKKKEKQPKKAKKQKKGTKEKNKEEDE-KWKMS 387
           K +Q+  E++   +  E++     ++++ + ++  K+A++ +K   E+ K+ +E K K +
Sbjct: 79  KKLQRQAEELEQKRAAEQERLKELEEERLQAQEAAKQAEEARKQALEQQKQAEEAKAKQA 138

Query: 388 PSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQE 447
                 A  E     +E       +    ++   +   E K K        +  +    E
Sbjct: 139 KEAKAKAEAEAKAKEEERKAAAAAAKKAEEEAKAKAAAEAKAKAEAKAAAAEAKKKAEAE 198

Query: 448 LKNLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDK 487
            K    A  + +    +A  K + + K+    E   K   
Sbjct: 199 AKAAAEAEAKAKAEKAEAKAKAEAEAKEKAAAEAAKKAAA 238


>gnl|CDD|115324 pfam06658, DUF1168, Protein of unknown function (DUF1168).  This
           family consists of several hypothetical eukaryotic
           proteins of unknown function.
          Length = 142

 Score = 33.8 bits (77), Expect = 0.052
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEK 383
             EEK  KK+ K++K+  K KK+KK  K K  EE+  
Sbjct: 78  AAEEKTAKKRLKRQKK--KQKKKKKKLKPKTTEEEVS 112


>gnl|CDD|116556 pfam07946, DUF1682, Protein of unknown function (DUF1682).  The
           members of this family are all hypothetical eukaryotic
           proteins of unknown function. One member is described as
           being an adipocyte-specific protein, but no evidence of
           this was found.
          Length = 325

 Score = 33.4 bits (77), Expect = 0.056
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 331 SDKTIQQVIEDI--IANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNK-EEDEKWK 385
            DKT +Q  E I     +E  E+ ++KK++K+K  ++A   K   +E+ K EE E+ K
Sbjct: 265 IDKTREQEEEKIVKATEEERAEEAQEKKEEKKKAEREALLAKLSPEEQRKYEEKEREK 322



 Score = 32.6 bits (75), Expect = 0.10
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 6/61 (9%)

Query: 328 IIFSDKTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMS 387
           I  S + +++    I   +E+EE+   K  ++E+  +  +K+++  K+K + E    K+S
Sbjct: 255 IELSPEVLRK----IDKTREQEEEKIVKATEEERAEEAQEKKEE--KKKAEREALLAKLS 308

Query: 388 P 388
           P
Sbjct: 309 P 309


>gnl|CDD|118043 pfam09507, CDC27, DNA polymerase subunit Cdc27.  This protein forms
           the C subunit of DNA polymerase delta. It carries the
           essential residues for binding to the Pol1 subunit of
           polymerase alpha, from residues 293-332, which are
           characterised by the motif D-G-VT, referred to as the
           DPIM motif. The first 160 residues of the protein form
           the minimal domain for binding to the B subunit, Cdc1,
           of polymerase delta, the final 10 C-terminal residues,
           362-372, being the DNA sliding clamp, PCNA, binding
           motif.
          Length = 406

 Score = 33.7 bits (77), Expect = 0.060
 Identities = 28/145 (19%), Positives = 57/145 (39%), Gaps = 8/145 (5%)

Query: 349 EEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWMK 408
             K KKK     ++ KK +K+ +G    + EE+++ +  P     A        ++   +
Sbjct: 207 APKPKKKSPLPSEEEKKERKRVEGEDLSDDEEEDEDE--PLKPKEAKPTSPQKTRKSRKE 264

Query: 409 KDESWNFSQDYDPELIKEEKRKELQSE-----IRIQVDELMRQELKNLKLAVDRERERPV 463
           ++E      + D E  +  K+K    E       + V E    E       V ++ E  V
Sbjct: 265 REEDLKRMMEDDDEKEEPAKKKRRIKEPKKAEEELDVPEPDE-EEGPPDEPVAKKEEPKV 323

Query: 464 KAGKKKDKKGKKGKKKEKKAKKDKD 488
           +      ++  + +  +KK  KD++
Sbjct: 324 EKTVSGGRRRGRRRVMKKKTFKDEE 348



 Score = 32.9 bits (75), Expect = 0.085
 Identities = 27/151 (17%), Positives = 57/151 (37%), Gaps = 29/151 (19%)

Query: 346 QEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEI 405
            ++E++   KKK++ K+PKKA+++    +   +E      ++                  
Sbjct: 275 DDDEKEEPAKKKRRIKEPKKAEEELDVPEPDEEEGPPDEPVAK----------------- 317

Query: 406 WMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDE----LMRQELKNLKLAVDRERER 461
             K++     +        +  +R+ ++ +     DE    + ++  +    +   E   
Sbjct: 318 --KEEPKVEKTVS---GGRRRGRRRVMKKKTF--KDEEGYLVTKKVYEWESCSEKEEAPP 370

Query: 462 PVKA-GKKKDKKGKKGKKKEKKAKKDKDLTA 491
           P K   KKK  K  K  K  KK KK   + +
Sbjct: 371 PPKKKPKKKPAKEAKAPKTAKKPKKQGSIMS 401


>gnl|CDD|118005 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2
           complex component).  RNases H are enzymes that
           specifically hydrolyse RNA when annealed to a
           complementary DNA and are present in all living
           organisms. In yeast RNase H2 is composed of a complex of
           three proteins (Rnh2Ap, Ydr279p and Ylr154p), this
           family represents the homologues of Ydr279p. It is not
           known whether non yeast proteins in this family fulfill
           the same function.
          Length = 285

 Score = 33.1 bits (76), Expect = 0.068
 Identities = 22/91 (24%), Positives = 36/91 (39%), Gaps = 8/91 (8%)

Query: 292 DIKENLQDQIRHWFIECRNLTGTFP----DYPDVEEGGSAIIFSDKTIQQVIEDIIANQE 347
           D+    +D+    F+    L             + E  ++ +  D + +++ E     + 
Sbjct: 189 DLLSETKDRYSAGFLSEYLLPSLLCKILYKSLQLPESLASSLNKDFSRKRLAESDAEVEA 248

Query: 348 EEEK----NKKKKKKKEKQPKKAKKQKKGTK 374
            E+      KKKKKKK    KK KK  KG K
Sbjct: 249 REDPKRRKEKKKKKKKRGVKKKKKKVAKGMK 279



 Score = 32.4 bits (74), Expect = 0.12
 Identities = 23/120 (19%), Positives = 43/120 (35%), Gaps = 8/120 (6%)

Query: 364 KKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWMK---KDESWN---FSQ 417
            K ++  K   +  +E   K  +   L    + E  + Y   ++             +  
Sbjct: 160 AKVERLVKYLPKSLEERFVKQALESELPKDLLSETKDRYSAGFLSEYLLPSLLCKILYKS 219

Query: 418 DYDPELIKEEKRKELQSEIRIQVDEL--MRQELKNLKLAVDRERERPVKAGKKKDKKGKK 475
              PE +     K+   +   + D     R++ K  K    ++++R VK  KKK  KG K
Sbjct: 220 LQLPESLASSLNKDFSRKRLAESDAEVEAREDPKRRKEKKKKKKKRGVKKKKKKVAKGMK 279


>gnl|CDD|117073 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal.  This
           domain is found to the N-terminus of bacterial signal
           peptidases of the S49 family (pfam01343).
          Length = 157

 Score = 33.0 bits (76), Expect = 0.089
 Identities = 15/45 (33%), Positives = 21/45 (46%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLF 391
           E    +K + K  EK  KK +KQK   K+   ++    K  P LF
Sbjct: 59  EAFLLDKAELKAWEKAEKKKEKQKAKAKKNKAKKGLADKRKPRLF 103



 Score = 29.5 bits (67), Expect = 0.84
 Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 333 KTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQ--KKGTKEKNK 378
           K +++ +E  + ++ E +  +K +KKKEKQ  KAKK   KKG  +K K
Sbjct: 52  KELKERLEAFLLDKAELKAWEKAEKKKEKQKAKAKKNKAKKGLADKRK 99


>gnl|CDD|116955 pfam08374, Protocadherin, Protocadherin.  The structure of
           protocadherins is similar to that of classic cadherins
           (pfam00028), but particularly on the cytoplasmic domains
           they also have some unique features. They are expressed
           in a variety of organisms and are found in high
           concentrations in the brain where they seem to be
           localised mainly at cell-cell contact sites. Their
           expression seems to be developmentally regulated.
          Length = 223

 Score = 31.8 bits (72), Expect = 0.22
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 345 NQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWK-MSPSLFLPAMKE 397
           N E ++   KKKKKK+K+  K       T E++K +DE    ++ +L LP M +
Sbjct: 85  NPENKQSKGKKKKKKKKKSPKPLLLNFVTIEESKPDDEDEDGLNKTLSLPLMLD 138


>gnl|CDD|115800 pfam07169, Triadin, Triadin.  This family consists of several
           eukaryotic triadin proteins. Triadin is a ryanodine
           receptor and calsequestrin binding protein located in
           junctional sarcoplasmic reticulum of striated muscles.
          Length = 265

 Score = 31.3 bits (70), Expect = 0.25
 Identities = 41/148 (27%), Positives = 65/148 (43%), Gaps = 8/148 (5%)

Query: 340 EDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGC 399
           EDI   + EE   K+K+  KEK  K+ K +KK   +    E EK K       P  K   
Sbjct: 126 EDIDKGEIEEPPLKQKEIHKEKAEKEEKPEKKILAKVAHREKEKGKEKLKGEKPEKKA-- 183

Query: 400 NAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRER 459
             +KE   KK++        + + IK + + E +++  ++     +QE    K A  + +
Sbjct: 184 -THKEKIEKKEKPETKMAAKEDKKIKTKAKTEEKAKKEMKGG---KQE--KAKPAAAKAK 237

Query: 460 ERPVKAGKKKDKKGKKGKKKEKKAKKDK 487
           E P    K K+K  K+     K  +KDK
Sbjct: 238 ETPKTPPKAKEKDDKETAAVAKHEQKDK 265


>gnl|CDD|116385 pfam07771, TSGP1, Tick salivary peptide group 1.  This contains a
           group of peptides derived from a salivary gland cDNA
           library of the tick Ixodes scapularis. Also present are
           peptides from a related tick species, Ixodes ricinus.
           They are characterised by a putative signal peptide
           indicative of secretion and conserved cysteine residues.
          Length = 120

 Score = 31.1 bits (70), Expect = 0.28
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 348 EEEKNKKKKKKKEKQPKKAKKQ 369
           E+ K KKKK KK K+PK+  K+
Sbjct: 98  EKPKQKKKKPKKTKKPKRTSKK 119



 Score = 30.3 bits (68), Expect = 0.51
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 456 DRERERPVKAGKKKDKKGKKGKKKEKKAKKD 486
           D     P +  K+K KK KK KK ++ +KKD
Sbjct: 90  DDYTPEPTEKPKQKKKKPKKTKKPKRTSKKD 120


>gnl|CDD|117151 pfam08576, DUF1764, Eukaryotic protein of unknown function
           (DUF1764).  This is a family of eukaryotic proteins of
           unknown function. This family contains many hypothetical
           proteins.
          Length = 106

 Score = 30.3 bits (68), Expect = 0.52
 Identities = 15/59 (25%), Positives = 30/59 (50%)

Query: 330 FSDKTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSP 388
                 +  IEDI  N + ++KN K+ +  + +  K+ K+KK + EK+ +  +    +P
Sbjct: 11  KDISEAKSKIEDIFNNIKVKDKNPKENETGKIKKNKSPKKKKSSDEKDDKFTDSRGKNP 69


>gnl|CDD|117636 pfam09073, BUD22, BUD22.  BUD22 has been shown in yeast to be a
           nuclear protein involved in bud-site selection. It plays
           a role in positioning the proximal bud pole signal.
          Length = 432

 Score = 30.2 bits (68), Expect = 0.63
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 327 AIIFSDKTIQQVIEDIIANQE----EEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDE 382
           A + + K ++ +I +I+   +     E+K KKKK KK+    KAK       E   E+ +
Sbjct: 120 ARLLNSKPVKNLIPNIMDGIKKLLGLEDKKKKKKDKKDAGKSKAKAADTSEDEDPDEDSD 179


>gnl|CDD|114487 pfam05764, YL1, YL1 nuclear protein.  The proteins in this family
           are designated YL1. These proteins have been shown to be
           DNA-binding and may be a transcription factor.
          Length = 237

 Score = 30.0 bits (68), Expect = 0.68
 Identities = 30/129 (23%), Positives = 52/129 (40%), Gaps = 16/129 (12%)

Query: 347 EEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIW 406
           ++EE+ +K+ +++E+  KK + + K  KE  K      K        A      A +   
Sbjct: 68  DDEEEGEKELQREERLKKKKRVKTKAYKEPTK------KKKKKDPTAAKSPKAAAPRPKK 121

Query: 407 MKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAG 466
             +  SW       P L+   +RK      R    +      + LK    R ++   KA 
Sbjct: 122 KSERISW------LPTLLDSPRRK----SSRSSTVQNKEATHERLKEREIRRKKIQAKAA 171

Query: 467 KKKDKKGKK 475
           K+K+KK +K
Sbjct: 172 KRKEKKKEK 180


>gnl|CDD|110124 pfam01101, HMG14_17, HMG14 and HMG17. 
          Length = 83

 Score = 30.1 bits (67), Expect = 0.69
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 452 KLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDKDLTAD 492
           K A  +   +P KA  KK KKG KGKK E   ++ +   A+
Sbjct: 24  KPAPPKPEPKPKKAAAKKGKKGPKGKKAEATNQEQEKNPAE 64


>gnl|CDD|109660 pfam00612, IQ, IQ calmodulin-binding motif.  Calmodulin-binding
           motif.
          Length = 21

 Score = 30.0 bits (69), Expect = 0.70
 Identities = 8/18 (44%), Positives = 11/18 (61%)

Query: 209 AAALRIQKVWRRFHQRKE 226
            AA++IQ  WR +  RK 
Sbjct: 2   KAAIKIQAAWRGYLARKR 19


>gnl|CDD|111770 pfam02919, Topoisom_I_N, Eukaryotic DNA topoisomerase I, DNA
           binding fragment.  Topoisomerase I promotes the
           relaxation of DNA superhelical tension by introducing a
           transient single-stranded break in duplex DNA and are
           vital for the processes of replication, transcription,
           and recombination. This family may be more than one
           structural domain.
          Length = 216

 Score = 29.6 bits (67), Expect = 0.95
 Identities = 11/30 (36%), Positives = 21/30 (70%)

Query: 356 KKKKEKQPKKAKKQKKGTKEKNKEEDEKWK 385
           +K+KEK+    K++KK  KE+ ++ +EK+ 
Sbjct: 97  QKQKEKKKAMTKEEKKAIKEEKEKLEEKYG 126


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.316    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0609    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 7,267,994
Number of extensions: 737941
Number of successful extensions: 3718
Number of sequences better than  1.0: 1
Number of HSP's gapped: 2770
Number of HSP's successfully gapped: 208
Length of query: 822
Length of database: 1,940,249
Length adjustment: 92
Effective length of query: 730
Effective length of database: 988,969
Effective search space: 721947370
Effective search space used: 721947370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.1 bits)